Anti-FHOD1
Catalog Number:
ATA-HPA024468
- Images (9)
| Article Name: | Anti-FHOD1 |
| Biozol Catalog Number: | ATA-HPA024468 |
| Supplier Catalog Number: | HPA024468 |
| Alternative Catalog Number: | ATA-HPA024468-100,ATA-HPA024468-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FHOS |
| formin homology 2 domain containing 1 |
| Anti-FHOD1 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 29109 |
| UniProt: | Q9Y613 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | AMPNEAGGHPDARQLWDSPETAPAARTPQSPAPCVLLRAQRSLAPEPKEPLIPASPKAEPIWELPTRAPRLSIGDLDFSDLGEDEDQDMLNVESVEAGKDIPAPSPPLPLLSGVP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FHOD1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |









