Anti-FHOD1

Catalog Number: ATA-HPA024468
Article Name: Anti-FHOD1
Biozol Catalog Number: ATA-HPA024468
Supplier Catalog Number: HPA024468
Alternative Catalog Number: ATA-HPA024468-100,ATA-HPA024468-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FHOS
formin homology 2 domain containing 1
Anti-FHOD1
Clonality: Polyclonal
Isotype: IgG
NCBI: 29109
UniProt: Q9Y613
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: AMPNEAGGHPDARQLWDSPETAPAARTPQSPAPCVLLRAQRSLAPEPKEPLIPASPKAEPIWELPTRAPRLSIGDLDFSDLGEDEDQDMLNVESVEAGKDIPAPSPPLPLLSGVP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FHOD1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemical staining of human gastrointestinal shows strong cytoplasmic positivity in lymphoid cells.
Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.
Immunohistochemical staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.
Immunohistochemical staining of human cerebellum shows no cytoplasmic positivity in Purkinje cells as expected.
HPA024468-100ul
HPA024468-100ul
HPA024468-100ul