Anti-FHOD1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-FHOD1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA024468
• Supplier Catalog Number: HPA024468
• Alternative Catalog Number: ATA-HPA024468-100,ATA-HPA024468-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FHOS

Product Description

formin homology 2 domain containing 1

Additional Information

Anti-FHOD1

Product Properties

• Clonality: Polyclonal
• Isotype: IgG
• NCBI: 29109
• UniProt: Q9Y613
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: AMPNEAGGHPDARQLWDSPETAPAARTPQSPAPCVLLRAQRSLAPEPKEPLIPASPKAEPIWELPTRAPRLSIGDLDFSDLGEDEDQDMLNVESVEAGKDIPAPSPPLPLLSGVP
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: FHOD1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500

Images

Immunofluorescent staining of human cell line A-431 shows localization to cytosol.

Immunohistochemical staining of human gastrointestinal shows strong cytoplasmic positivity in lymphoid cells.

Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.

Immunohistochemical staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.

Immunohistochemical staining of human cerebellum shows no cytoplasmic positivity in Purkinje cells as expected.

HPA024468

HPA024468

HPA024468