Anti-FAM83H

Artikelnummer: ATA-HPA024505
Artikelname: Anti-FAM83H
Artikelnummer: ATA-HPA024505
Hersteller Artikelnummer: HPA024505
Alternativnummer: ATA-HPA024505-100,ATA-HPA024505-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ46072
family with sequence similarity 83, member H
Anti-FAM83H
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 286077
UniProt: Q6ZRV2
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SDKDKCSAIFRSDSLGTQGRLSRTLPASAEERDRLLRRMESMRKEKRVYSRFEVFCKKEEASSPGAGEGPAEEGTRDSKVGKFVPKILGTF
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: FAM83H
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human skin and skeletal muscle tissues using Anti-FAM83H antibody. Corresponding FAM83H RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skin shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis in human cell line MCF-7.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA024505-100ul
HPA024505-100ul
HPA024505-100ul