Anti-FAM83H

Catalog Number: ATA-HPA024505
Article Name: Anti-FAM83H
Biozol Catalog Number: ATA-HPA024505
Supplier Catalog Number: HPA024505
Alternative Catalog Number: ATA-HPA024505-100,ATA-HPA024505-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ46072
family with sequence similarity 83, member H
Anti-FAM83H
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 286077
UniProt: Q6ZRV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SDKDKCSAIFRSDSLGTQGRLSRTLPASAEERDRLLRRMESMRKEKRVYSRFEVFCKKEEASSPGAGEGPAEEGTRDSKVGKFVPKILGTF
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FAM83H
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human skin and skeletal muscle tissues using Anti-FAM83H antibody. Corresponding FAM83H RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skin shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis in human cell line MCF-7.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA024505-100ul
HPA024505-100ul
HPA024505-100ul