Anti-GREB1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA024616
Artikelname: Anti-GREB1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA024616
Hersteller Artikelnummer: HPA024616
Alternativnummer: ATA-HPA024616-100,ATA-HPA024616-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA0575
growth regulation by estrogen in breast cancer 1
Anti-GREB1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 9687
UniProt: Q4ZG55
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EGDIDILLDKFHQENQGHISSSLAASSVTKAASLDVSGTPVCTSYNLEPHSIRPFQLAVAQKLLSHVCSIADSSTQNLDLGSFEKVDFLICIP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: GREB1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria.
Immunohistochemical staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in proximal tubules.
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in keratinocytes.
HPA024616
HPA024616
HPA024616