Anti-GREB1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-GREB1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA024616
• Supplier Catalog Number: HPA024616
• Alternative Catalog Number: ATA-HPA024616-100,ATA-HPA024616-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: KIAA0575

Product Description

growth regulation by estrogen in breast cancer 1

Additional Information

Anti-GREB1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 9687
• UniProt: Q4ZG55
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: EGDIDILLDKFHQENQGHISSSLAASSVTKAASLDVSGTPVCTSYNLEPHSIRPFQLAVAQKLLSHVCSIADSSTQNLDLGSFEKVDFLICIP
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: GREB1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000

Images

Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria.

Immunohistochemical staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in proximal tubules.

Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in keratinocytes.

HPA024616

HPA024616

HPA024616