Anti-GREB1

Catalog Number: ATA-HPA024616
Article Name: Anti-GREB1
Biozol Catalog Number: ATA-HPA024616
Supplier Catalog Number: HPA024616
Alternative Catalog Number: ATA-HPA024616-100,ATA-HPA024616-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0575
growth regulation by estrogen in breast cancer 1
Anti-GREB1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 9687
UniProt: Q4ZG55
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EGDIDILLDKFHQENQGHISSSLAASSVTKAASLDVSGTPVCTSYNLEPHSIRPFQLAVAQKLLSHVCSIADSSTQNLDLGSFEKVDFLICIP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GREB1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria.
Immunohistochemical staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in proximal tubules.
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in keratinocytes.
HPA024616-100ul
HPA024616-100ul
HPA024616-100ul