Anti-RRP15

Artikelnummer: ATA-HPA024639
Artikelname: Anti-RRP15
Artikelnummer: ATA-HPA024639
Hersteller Artikelnummer: HPA024639
Alternativnummer: ATA-HPA024639-100,ATA-HPA024639-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CGI-115, KIAA0507
ribosomal RNA processing 15 homolog (S. cerevisiae)
Anti-RRP15
Klonalität: Polyclonal
Konzentration: 0.4 mg/ml
Isotyp: IgG
NCBI: 51018
UniProt: Q9Y3B9
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VSEEENLKKTPKKKMKMVTGAVASVLEDEATDTSDSEGSCGSEKDHFYSDDDAIEADSEGDAEPCDKENENDGESSVGTN
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RRP15
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & mitochondria.
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA024639-100ul
HPA024639-100ul
HPA024639-100ul