Anti-RRP15

Catalog Number: ATA-HPA024639
Article Name: Anti-RRP15
Biozol Catalog Number: ATA-HPA024639
Supplier Catalog Number: HPA024639
Alternative Catalog Number: ATA-HPA024639-100,ATA-HPA024639-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CGI-115, KIAA0507
ribosomal RNA processing 15 homolog (S. cerevisiae)
Anti-RRP15
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 51018
UniProt: Q9Y3B9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VSEEENLKKTPKKKMKMVTGAVASVLEDEATDTSDSEGSCGSEKDHFYSDDDAIEADSEGDAEPCDKENENDGESSVGTN
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RRP15
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & mitochondria.
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA024639-100ul
HPA024639-100ul
HPA024639-100ul