Anti-KIAA1456 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA024673
Artikelname: Anti-KIAA1456 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA024673
Hersteller Artikelnummer: HPA024673
Alternativnummer: ATA-HPA024673-100,ATA-HPA024673-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C8orf79, FLJ36980
KIAA1456
Anti-KIAA1456
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 57604
UniProt: Q9P272
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: HPPCSECSCSVCFKEQCGSKRSHSVGYEPAMARTCFANISKEGEEEYGFYSTLGKSFRSWFFSRSLDESTL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: KIAA1456
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line BJ shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemical staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human pancreas shows very weak cytoplasmic positivity in exocrine glandular cells.
HPA024673
HPA024673
HPA024673