Anti-KIAA1456 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-KIAA1456 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA024673
• Supplier Catalog Number: HPA024673
• Alternative Catalog Number: ATA-HPA024673-100,ATA-HPA024673-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: C8orf79, FLJ36980

Product Description

KIAA1456

Additional Information

Anti-KIAA1456

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 57604
• UniProt: Q9P272
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: HPPCSECSCSVCFKEQCGSKRSHSVGYEPAMARTCFANISKEGEEEYGFYSTLGKSFRSWFFSRSLDESTL
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: KIAA1456
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50

Images

Immunofluorescent staining of human cell line BJ shows localization to nucleoplasm & cytosol.

Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemical staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human pancreas shows very weak cytoplasmic positivity in exocrine glandular cells.

HPA024673

HPA024673

HPA024673