Anti-EIF4G3

Artikelnummer: ATA-HPA025041
Artikelname: Anti-EIF4G3
Artikelnummer: ATA-HPA025041
Hersteller Artikelnummer: HPA025041
Alternativnummer: ATA-HPA025041-100,ATA-HPA025041-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: eIF4GII
eukaryotic translation initiation factor 4 gamma, 3
Anti-EIF4G3
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 8672
UniProt: O43432
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VARSTIAAPTSSALSSQPIFTTAIDDRCELSSPREDTIPIPSLTSCTETSDPLPTNENDDDICKKPCSVAPNDIPLV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: EIF4G3
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-EIF4G3 antibody. Corresponding EIF4G3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, lymph node, skeletal muscle and testis using Anti-EIF4G3 antibody HPA025041 (A) shows similar protein distribution across tissues to independent antibody HPA025031 (B).
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Immunohistochemical staining of human lymph node using Anti-EIF4G3 antibody HPA025041.
Immunohistochemical staining of human cerebral cortex using Anti-EIF4G3 antibody HPA025041.
HPA025041-100ul
HPA025041-100ul
HPA025041-100ul