Anti-EIF4G3 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-EIF4G3 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA025041
• Supplier Catalog Number: HPA025041
• Alternative Catalog Number: ATA-HPA025041-100,ATA-HPA025041-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: eIF4GII

Product Description

eukaryotic translation initiation factor 4 gamma, 3

Additional Information

Anti-EIF4G3

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 8672
• UniProt: O43432
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: VARSTIAAPTSSALSSQPIFTTAIDDRCELSSPREDTIPIPSLTSCTETSDPLPTNENDDDICKKPCSVAPNDIPLV
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: EIF4G3
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-EIF4G3 antibody. Corresponding EIF4G3 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebral cortex, lymph node, skeletal muscle and testis using Anti-EIF4G3 antibody HPA025041 (A) shows similar protein distribution across tissues to independent antibody HPA025031 (B).

Immunohistochemical staining of human testis shows high expression.

Immunohistochemical staining of human skeletal muscle shows low expression as expected.

Immunohistochemical staining of human lymph node using Anti-EIF4G3 antibody HPA025041.

Immunohistochemical staining of human cerebral cortex using Anti-EIF4G3 antibody HPA025041.

HPA025041

HPA025041

HPA025041