Anti-MRPL37

Artikelnummer: ATA-HPA025767
Artikelname: Anti-MRPL37
Artikelnummer: ATA-HPA025767
Hersteller Artikelnummer: HPA025767
Alternativnummer: ATA-HPA025767-100,ATA-HPA025767-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MRP-L2, RPML2
mitochondrial ribosomal protein L37
Anti-MRPL37
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 51253
UniProt: Q9BZE1
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TDGRVFHFLVFQLNTTDLDSNEGVKNLAWVDSDQLLYQHFWCLPVIKKRVVVEPVGPVGFKPETFRKFLALYLHGA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MRPL37
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human rectum shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemical staining of human endometrium shows weak cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human pancreas shows weak granular cytoplasmic positivity in exocrine glandular cells.
Western blot analysis using Anti-MRPL37 antibody HPA025767 (A) shows similar pattern to independent antibody HPA025826 (B).
HPA025767-100ul
HPA025767-100ul
HPA025767-100ul