Anti-MRPL37

Catalog Number: ATA-HPA025767
Article Name: Anti-MRPL37
Biozol Catalog Number: ATA-HPA025767
Supplier Catalog Number: HPA025767
Alternative Catalog Number: ATA-HPA025767-100,ATA-HPA025767-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MRP-L2, RPML2
mitochondrial ribosomal protein L37
Anti-MRPL37
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 51253
UniProt: Q9BZE1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TDGRVFHFLVFQLNTTDLDSNEGVKNLAWVDSDQLLYQHFWCLPVIKKRVVVEPVGPVGFKPETFRKFLALYLHGA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MRPL37
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human rectum shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemical staining of human endometrium shows weak cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human pancreas shows weak granular cytoplasmic positivity in exocrine glandular cells.
Western blot analysis using Anti-MRPL37 antibody HPA025767 (A) shows similar pattern to independent antibody HPA025826 (B).
HPA025767-100ul
HPA025767-100ul
HPA025767-100ul