Anti-MRPL37 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA025767
- Images (9)
| Article Name: | Anti-MRPL37 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA025767 |
| Supplier Catalog Number: | HPA025767 |
| Alternative Catalog Number: | ATA-HPA025767-100,ATA-HPA025767-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MRP-L2, RPML2 |
| mitochondrial ribosomal protein L37 |
| Anti-MRPL37 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 51253 |
| UniProt: | Q9BZE1 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | TDGRVFHFLVFQLNTTDLDSNEGVKNLAWVDSDQLLYQHFWCLPVIKKRVVVEPVGPVGFKPETFRKFLALYLHGA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MRPL37 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human rectum shows moderate granular cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human endometrium shows weak cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human pancreas shows weak granular cytoplasmic positivity in exocrine glandular cells. |
|
|
Western blot analysis using Anti-MRPL37 antibody HPA025767 (A) shows similar pattern to independent antibody HPA025826 (B). |
|
|
HPA025767 |
|
|
|
|
|
HPA025767 |
|
|
HPA025767 |
Product Guarantee and Expert Support
