Anti-MRPL37 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA025826
Artikelname: Anti-MRPL37 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA025826
Hersteller Artikelnummer: HPA025826
Alternativnummer: ATA-HPA025826-100,ATA-HPA025826-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MRP-L2, RPML2
mitochondrial ribosomal protein L37
Anti-MRPL37
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 51253
UniProt: Q9BZE1
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SATWNRESLLLQVRGSGGARLSTKDPLPTIASREEIEATKNHVLETFYPISPIIDLHECNIYDVK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MRPL37
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human rectum and pancreas tissues using Anti-MRPL37 antibody. Corresponding MRPL37 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human pancreas shows low expression as expected.
Immunohistochemical staining of human rectum shows high expression.
Western blot analysis in Hep-G2 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-MRPL37 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Western blot analysis using Anti-MRPL37 antibody HPA025826 (A) shows similar pattern to independent antibody HPA025767 (B).
HPA025826
HPA025826
HPA025826