Anti-MRPL37 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA025826
- Images (9)
| Article Name: | Anti-MRPL37 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA025826 |
| Supplier Catalog Number: | HPA025826 |
| Alternative Catalog Number: | ATA-HPA025826-100,ATA-HPA025826-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MRP-L2, RPML2 |
| mitochondrial ribosomal protein L37 |
| Anti-MRPL37 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 51253 |
| UniProt: | Q9BZE1 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SATWNRESLLLQVRGSGGARLSTKDPLPTIASREEIEATKNHVLETFYPISPIIDLHECNIYDVK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MRPL37 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human rectum and pancreas tissues using Anti-MRPL37 antibody. Corresponding MRPL37 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human rectum shows high expression. |
|
|
Western blot analysis in Hep-G2 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-MRPL37 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB. |
|
|
Western blot analysis using Anti-MRPL37 antibody HPA025826 (A) shows similar pattern to independent antibody HPA025767 (B). |
|
|
HPA025826 |
|
|
|
|
|
HPA025826 |
|
|
HPA025826 |
Product Guarantee and Expert Support
