Anti-MRPL37 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA025951
Artikelname: Anti-MRPL37 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA025951
Hersteller Artikelnummer: HPA025951
Alternativnummer: ATA-HPA025951-100,ATA-HPA025951-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MRP-L2, RPML2
mitochondrial ribosomal protein L37
Anti-MRPL37
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 51253
UniProt: Q9BZE1
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LTKTKLIEGLPEKVLSLVDDPRNHIENQDECVLNVISHARLWQTTEEIPKRETYCPVIVDNLIQLCKSQILKHP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MRPL37
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemical staining of human kidney shows weak to moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human stomach shows moderate cytoplasmic positivity in glandular cells.
HPA025951
HPA025951
HPA025951