Anti-MRPL37

Catalog Number: ATA-HPA025951
Article Name: Anti-MRPL37
Biozol Catalog Number: ATA-HPA025951
Supplier Catalog Number: HPA025951
Alternative Catalog Number: ATA-HPA025951-100,ATA-HPA025951-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MRP-L2, RPML2
mitochondrial ribosomal protein L37
Anti-MRPL37
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 51253
UniProt: Q9BZE1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LTKTKLIEGLPEKVLSLVDDPRNHIENQDECVLNVISHARLWQTTEEIPKRETYCPVIVDNLIQLCKSQILKHP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MRPL37
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemical staining of human kidney shows weak to moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human stomach shows moderate cytoplasmic positivity in glandular cells.
HPA025951-100ul
HPA025951-100ul
HPA025951-100ul