Anti-MRPL37 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-MRPL37 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA025951
• Supplier Catalog Number: HPA025951
• Alternative Catalog Number: ATA-HPA025951-100,ATA-HPA025951-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: MRP-L2, RPML2

Product Description

mitochondrial ribosomal protein L37

Additional Information

Anti-MRPL37

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 51253
• UniProt: Q9BZE1
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: LTKTKLIEGLPEKVLSLVDDPRNHIENQDECVLNVISHARLWQTTEEIPKRETYCPVIVDNLIQLCKSQILKHP
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: MRPL37
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500

Images

Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.

Immunohistochemical staining of human kidney shows weak to moderate granular cytoplasmic positivity in cells in tubules.

Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

HPA025951

HPA025951

HPA025951