Anti-PTK2B
Artikelnummer:
ATA-HPA026091
- Bilder (7)
| Artikelname: | Anti-PTK2B |
| Artikelnummer: | ATA-HPA026091 |
| Hersteller Artikelnummer: | HPA026091 |
| Alternativnummer: | ATA-HPA026091-100,ATA-HPA026091-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CADTK, CAKB, FAK2, PTK, PYK2, RAFTK |
| protein tyrosine kinase 2 beta |
| Anti-PTK2B |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2185 |
| UniProt: | Q14289 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPM |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PTK2B |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells. |
|
|
Western blot analysis in human cell lines A-431 and HEK293 using Anti-PTK2B antibody. Corresponding PTK2B RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
Western blot analysis using Anti-PTK2B antibody HPA026091 (A) shows similar pattern to independent antibody HPA026276 (B). |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA026091-100ul |
|
|
HPA026091-100ul |
|
|
HPA026091-100ul |
Produktgarantie und fachkundiger Support
