Anti-PTK2B
Catalog Number:
ATA-HPA026091
- Images (7)
| Article Name: | Anti-PTK2B |
| Biozol Catalog Number: | ATA-HPA026091 |
| Supplier Catalog Number: | HPA026091 |
| Alternative Catalog Number: | ATA-HPA026091-100,ATA-HPA026091-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CADTK, CAKB, FAK2, PTK, PYK2, RAFTK |
| protein tyrosine kinase 2 beta |
| Anti-PTK2B |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 2185 |
| UniProt: | Q14289 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | TLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPM |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PTK2B |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells. |
|
|
Western blot analysis in human cell lines A-431 and HEK293 using Anti-PTK2B antibody. Corresponding PTK2B RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
Western blot analysis using Anti-PTK2B antibody HPA026091 (A) shows similar pattern to independent antibody HPA026276 (B). |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA026091-100ul |
|
|
HPA026091-100ul |
|
|
HPA026091-100ul |
Product Guarantee and Expert Support
