Anti-RPA2

Artikelnummer: ATA-HPA026306
Artikelname: Anti-RPA2
Artikelnummer: ATA-HPA026306
Hersteller Artikelnummer: HPA026306
Alternativnummer: ATA-HPA026306-100,ATA-HPA026306-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: RPA2
replication protein A2, 32kDa
Anti-RPA2
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 6118
UniProt: P15927
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: HMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDH
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RPA2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies.
Immunohistochemical staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
Western blot analysis using Anti-RPA2 antibody HPA026306 (A) shows similar pattern to independent antibody HPA026309 (B).
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA026306-100ul
HPA026306-100ul
HPA026306-100ul