Anti-RPA2

Catalog Number: ATA-HPA026306
Article Name: Anti-RPA2
Biozol Catalog Number: ATA-HPA026306
Supplier Catalog Number: HPA026306
Alternative Catalog Number: ATA-HPA026306-100,ATA-HPA026306-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: RPA2
replication protein A2, 32kDa
Anti-RPA2
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 6118
UniProt: P15927
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: HMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDH
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RPA2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies.
Immunohistochemical staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
Western blot analysis using Anti-RPA2 antibody HPA026306 (A) shows similar pattern to independent antibody HPA026309 (B).
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA026306-100ul
HPA026306-100ul
HPA026306-100ul