Anti-GSDMC Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA026317
Artikelname: Anti-GSDMC Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA026317
Hersteller Artikelnummer: HPA026317
Alternativnummer: ATA-HPA026317-100,ATA-HPA026317-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MLZE
gasdermin C
Anti-GSDMC
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 56169
UniProt: Q9BYG8
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LPVGRIEEPFWQNFKHLQEEVFQKIKTLAQLSKDVQDVMFYSILAMLRDRGALQDLMNMLELDSSGHLDGPGGAILKKLQQDSNHAWFNPKDP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: GSDMC
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemical staining of human cervix, uterine shows weak to moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemical staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.
Immunohistochemical staining of human stomach shows weak to moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
HPA026317
HPA026317
HPA026317