Anti-GSDMC Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA026317
- Images (7)
| Article Name: | Anti-GSDMC Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA026317 |
| Supplier Catalog Number: | HPA026317 |
| Alternative Catalog Number: | ATA-HPA026317-100,ATA-HPA026317-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MLZE |
| gasdermin C |
| Anti-GSDMC |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 56169 |
| UniProt: | Q9BYG8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LPVGRIEEPFWQNFKHLQEEVFQKIKTLAQLSKDVQDVMFYSILAMLRDRGALQDLMNMLELDSSGHLDGPGGAILKKLQQDSNHAWFNPKDP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | GSDMC |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human cervix, uterine shows weak to moderate cytoplasmic positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human stomach shows weak to moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA026317 |
|
|
HPA026317 |
|
|
HPA026317 |
Product Guarantee and Expert Support
