Anti-PSMB2 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA026324
Artikelname: Anti-PSMB2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA026324
Hersteller Artikelnummer: HPA026324
Alternativnummer: ATA-HPA026324-100,ATA-HPA026324-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: HC7-I
proteasome (prosome, macropain) subunit, beta type, 2
Anti-PSMB2
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 5690
UniProt: P49721
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: YVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PSMB2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm.
Immunohistochemical staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
Immunohistochemical staining of human cerebellum shows moderate nuclear positivity in Purkinje cells.
Immunohistochemical staining of human colon shows moderate nuclear positivity in glandular cells.
Immunohistochemical staining of human kidney shows moderate to strong nuclear positivity in cells in tubules.
HPA026324
HPA026324
HPA026324