Anti-PSMB2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA026324
| Artikelname: |
Anti-PSMB2 Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
ATA-HPA026324 |
| Hersteller Artikelnummer: |
HPA026324 |
| Alternativnummer: |
ATA-HPA026324-100,ATA-HPA026324-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
ICC, IHC |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
HC7-I |
| proteasome (prosome, macropain) subunit, beta type, 2 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.05 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
5690 |
| UniProt: |
P49721 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
YVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTP |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
PSMB2 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm. |
|
Immunohistochemical staining of human fallopian tube shows moderate nuclear positivity in glandular cells. |
|
Immunohistochemical staining of human cerebellum shows moderate nuclear positivity in Purkinje cells. |
|
Immunohistochemical staining of human colon shows moderate nuclear positivity in glandular cells. |
|
Immunohistochemical staining of human kidney shows moderate to strong nuclear positivity in cells in tubules. |
|
|
|
HPA026324 |
|
HPA026324 |
|
HPA026324 |