Anti-PSMB2 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA026324
- Images (9)
| Article Name: | Anti-PSMB2 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA026324 |
| Supplier Catalog Number: | HPA026324 |
| Alternative Catalog Number: | ATA-HPA026324-100,ATA-HPA026324-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HC7-I |
| proteasome (prosome, macropain) subunit, beta type, 2 |
| Anti-PSMB2 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 5690 |
| UniProt: | P49721 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | YVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PSMB2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
|
Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human cerebellum shows moderate nuclear positivity in Purkinje cells. |
|
|
Immunohistochemical staining of human colon shows moderate nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong nuclear positivity in cells in tubules. |
|
|
|
|
|
HPA026324 |
|
|
HPA026324 |
|
|
HPA026324 |
Product Guarantee and Expert Support
