Anti-PSMB2

Catalog Number: ATA-HPA026324
Article Name: Anti-PSMB2
Biozol Catalog Number: ATA-HPA026324
Supplier Catalog Number: HPA026324
Alternative Catalog Number: ATA-HPA026324-100,ATA-HPA026324-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HC7-I
proteasome (prosome, macropain) subunit, beta type, 2
Anti-PSMB2
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 5690
UniProt: P49721
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PSMB2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm.
Immunohistochemical staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
Immunohistochemical staining of human cerebellum shows moderate nuclear positivity in Purkinje cells.
Immunohistochemical staining of human colon shows moderate nuclear positivity in glandular cells.
Immunohistochemical staining of human kidney shows moderate to strong nuclear positivity in cells in tubules.
HPA026324-100ul
HPA026324-100ul
HPA026324-100ul