Anti-C1QBP

Artikelnummer: ATA-HPA026483
Artikelname: Anti-C1QBP
Artikelnummer: ATA-HPA026483
Hersteller Artikelnummer: HPA026483
Alternativnummer: ATA-HPA026483-100,ATA-HPA026483-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: gC1Q-R, gC1qR, HABP1, p32, SF2p32
complement component 1, q subcomponent binding protein
Anti-C1QBP
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 708
UniProt: Q07021
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHY
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: C1QBP
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane.
Immunohistochemical staining of human lymph node shows strong granular cytoplasmic positivity in germinal center cells.
Western blot analysis in human cell lines HEK293 and U2OS using Anti-C1QBP antibody. Corresponding C1QBP RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA026483-100ul
HPA026483-100ul
HPA026483-100ul