Anti-C1QBP Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA026483
- Bilder (9)
| Artikelname: | Anti-C1QBP Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA026483 |
| Hersteller Artikelnummer: | HPA026483 |
| Alternativnummer: | ATA-HPA026483-100,ATA-HPA026483-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | gC1Q-R, gC1qR, HABP1, p32, SF2p32 |
| complement component 1, q subcomponent binding protein |
| Anti-C1QBP |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 708 |
| UniProt: | Q07021 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHY |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | C1QBP |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane. |
|
|
Immunohistochemical staining of human lymph node shows strong granular cytoplasmic positivity in germinal center cells. |
|
|
Western blot analysis in human cell lines HEK293 and U2OS using Anti-C1QBP antibody. Corresponding C1QBP RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA026483 |
|
|
|
|
|
|
|
|
HPA026483 |
|
|
HPA026483 |
Produktgarantie und fachkundiger Support
