Anti-C1QBP Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA026483
- Images (9)
| Article Name: | Anti-C1QBP Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA026483 |
| Supplier Catalog Number: | HPA026483 |
| Alternative Catalog Number: | ATA-HPA026483-100,ATA-HPA026483-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | gC1Q-R, gC1qR, HABP1, p32, SF2p32 |
| complement component 1, q subcomponent binding protein |
| Anti-C1QBP |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 708 |
| UniProt: | Q07021 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHY |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | C1QBP |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane. |
|
|
Immunohistochemical staining of human lymph node shows strong granular cytoplasmic positivity in germinal center cells. |
|
|
Western blot analysis in human cell lines HEK293 and U2OS using Anti-C1QBP antibody. Corresponding C1QBP RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA026483 |
|
|
|
|
|
|
|
|
HPA026483 |
|
|
HPA026483 |
Product Guarantee and Expert Support
