Anti-EPRS
Artikelnummer:
ATA-HPA026490
- Bilder (7)
| Artikelname: | Anti-EPRS |
| Artikelnummer: | ATA-HPA026490 |
| Hersteller Artikelnummer: | HPA026490 |
| Alternativnummer: | ATA-HPA026490-100,ATA-HPA026490-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | EARS, GLUPRORS, PARS, QARS, QPRS |
| glutamyl-prolyl-tRNA synthetase |
| Anti-EPRS |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2058 |
| UniProt: | P07814 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | CVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAIL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | EPRS |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-EPRS antibody. Remaining relative intensity is presented. |
|
|
Western blot analysis using Anti-EPRS antibody HPA026490 (A) shows similar pattern to independent antibody HPA030052 (B). |
|
|
HPA026490-100ul |
|
|
|
|
|
HPA026490-100ul |
|
|
HPA026490-100ul |
Produktgarantie und fachkundiger Support
