Anti-EPRS
Catalog Number:
ATA-HPA026490
- Images (7)
| Article Name: | Anti-EPRS |
| Biozol Catalog Number: | ATA-HPA026490 |
| Supplier Catalog Number: | HPA026490 |
| Alternative Catalog Number: | ATA-HPA026490-100,ATA-HPA026490-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | EARS, GLUPRORS, PARS, QARS, QPRS |
| glutamyl-prolyl-tRNA synthetase |
| Anti-EPRS |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 2058 |
| UniProt: | P07814 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | CVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAIL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | EPRS |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-EPRS antibody. Remaining relative intensity is presented. |
|
|
Western blot analysis using Anti-EPRS antibody HPA026490 (A) shows similar pattern to independent antibody HPA030052 (B). |
|
|
HPA026490-100ul |
|
|
|
|
|
HPA026490-100ul |
|
|
HPA026490-100ul |
Product Guarantee and Expert Support
