Anti-CD59

Artikelnummer: ATA-HPA026494
Artikelname: Anti-CD59
Artikelnummer: ATA-HPA026494
Hersteller Artikelnummer: HPA026494
Alternativnummer: ATA-HPA026494-100,ATA-HPA026494-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: 16.3A5, EJ16, EJ30, EL32, G344, MIC11, MIN1, MIN2, MIN3, MSK21, p18-20
CD59 molecule, complement regulatory protein
Anti-CD59
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 966
UniProt: P13987
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: CYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CD59
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles.
Immunohistochemical staining of human urinary bladder shows distinct membranous positivity in urothelial cells.
Western blot analysis in human cell lines PC-3 and Caco-2 using Anti-CD59 antibody. Corresponding CD59 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA026494-100ul
HPA026494-100ul
HPA026494-100ul