Anti-CD59 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA026494
- Images (9)
| Article Name: | Anti-CD59 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA026494 |
| Supplier Catalog Number: | HPA026494 |
| Alternative Catalog Number: | ATA-HPA026494-100,ATA-HPA026494-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | 16.3A5, EJ16, EJ30, EL32, G344, MIC11, MIN1, MIN2, MIN3, MSK21, p18-20 |
| CD59 molecule, complement regulatory protein |
| Anti-CD59 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 966 |
| UniProt: | P13987 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | CYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CD59 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles. |
|
|
Immunohistochemical staining of human urinary bladder shows distinct membranous positivity in urothelial cells. |
|
|
Western blot analysis in human cell lines PC-3 and Caco-2 using Anti-CD59 antibody. Corresponding CD59 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
HPA026494 |
|
|
|
|
|
|
|
|
HPA026494 |
|
|
HPA026494 |
Product Guarantee and Expert Support
