Anti-CD59

Catalog Number: ATA-HPA026494
Article Name: Anti-CD59
Biozol Catalog Number: ATA-HPA026494
Supplier Catalog Number: HPA026494
Alternative Catalog Number: ATA-HPA026494-100,ATA-HPA026494-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: 16.3A5, EJ16, EJ30, EL32, G344, MIC11, MIN1, MIN2, MIN3, MSK21, p18-20
CD59 molecule, complement regulatory protein
Anti-CD59
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 966
UniProt: P13987
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: CYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CD59
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles.
Immunohistochemical staining of human urinary bladder shows distinct membranous positivity in urothelial cells.
Western blot analysis in human cell lines PC-3 and Caco-2 using Anti-CD59 antibody. Corresponding CD59 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA026494-100ul
HPA026494-100ul
HPA026494-100ul