Anti-DNMT3A Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA026588
Artikelname: Anti-DNMT3A Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA026588
Hersteller Artikelnummer: HPA026588
Alternativnummer: ATA-HPA026588-100,ATA-HPA026588-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DNMT3A
DNA (cytosine-5-)-methyltransferase 3 alpha
Anti-DNMT3A
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 1788
UniProt: Q9Y6K1
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LPEASRAVENGCCTPKEGRGAPAEAGKEQKETNIESMKMEGSRGRLRGGLGWESSLRQRPMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAGMNAVEENQGPGESQKVEE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DNMT3A
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human lymph node shows strong nuclear positivity.
Immunohistochemical staining of human endometrium shows strong nuclear positivity.
Immunohistochemical staining of human kidney shows nuclear positivity in cells in glomeruli and tubular cells.
Immunohistochemical staining of human liver shows strong nuclear positivity in hepatocytes.
HPA026588
HPA026588
HPA026588