Anti-DNMT3A Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-DNMT3A Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA026588
• Supplier Catalog Number: HPA026588
• Alternative Catalog Number: ATA-HPA026588-100,ATA-HPA026588-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: DNMT3A

Product Description

DNA (cytosine-5-)-methyltransferase 3 alpha

Additional Information

Anti-DNMT3A

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 1788
• UniProt: Q9Y6K1
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: LPEASRAVENGCCTPKEGRGAPAEAGKEQKETNIESMKMEGSRGRLRGGLGWESSLRQRPMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAGMNAVEENQGPGESQKVEE
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: DNMT3A
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200

Images

Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Immunohistochemical staining of human lymph node shows strong nuclear positivity.

Immunohistochemical staining of human endometrium shows strong nuclear positivity.

Immunohistochemical staining of human kidney shows nuclear positivity in cells in glomeruli and tubular cells.

Immunohistochemical staining of human liver shows strong nuclear positivity in hepatocytes.

HPA026588

HPA026588

HPA026588