Anti-DNMT3A

Catalog Number: ATA-HPA026588
Article Name: Anti-DNMT3A
Biozol Catalog Number: ATA-HPA026588
Supplier Catalog Number: HPA026588
Alternative Catalog Number: ATA-HPA026588-100,ATA-HPA026588-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DNMT3A
DNA (cytosine-5-)-methyltransferase 3 alpha
Anti-DNMT3A
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 1788
UniProt: Q9Y6K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LPEASRAVENGCCTPKEGRGAPAEAGKEQKETNIESMKMEGSRGRLRGGLGWESSLRQRPMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAGMNAVEENQGPGESQKVEE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DNMT3A
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human lymph node shows strong nuclear positivity.
Immunohistochemical staining of human endometrium shows strong nuclear positivity.
Immunohistochemical staining of human kidney shows nuclear positivity in cells in glomeruli and tubular cells.
Immunohistochemical staining of human liver shows strong nuclear positivity in hepatocytes.
HPA026588-100ul
HPA026588-100ul
HPA026588-100ul