Anti-NCAPG2 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA026631
Artikelname: Anti-NCAPG2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA026631
Hersteller Artikelnummer: HPA026631
Alternativnummer: ATA-HPA026631-100,ATA-HPA026631-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CAP-G2, FLJ20311, hCAP-G2, LUZP5, MTB
non-SMC condensin II complex, subunit G2
Anti-NCAPG2
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 54892
UniProt: Q86XI2
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: QVGHILELVDNWLPTEHAQAKSNTASKGRVQIHDTRPVKPELALVYIEYLLTHPKNRECLLSAPRKKLNHLLKALETSKADLESLLQTPGGKPRGFSEAAAPRAFGLHCRLSIHLQH
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: NCAPG2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts and Leydig cells.
Immunohistochemical staining of human prostate shows moderate nuclear positivity in glandular cells.
Immunohistochemical staining of human tonsil shows moderate nuclear positivity in germinal center and non-germinal center cells.
Immunohistochemical staining of human skeletal muscle shows weak to moderate nuclear positivity in myocytes.
HPA026631
HPA026631
HPA026631