Anti-NCAPG2

Catalog Number: ATA-HPA026631
Article Name: Anti-NCAPG2
Biozol Catalog Number: ATA-HPA026631
Supplier Catalog Number: HPA026631
Alternative Catalog Number: ATA-HPA026631-100,ATA-HPA026631-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CAP-G2, FLJ20311, hCAP-G2, LUZP5, MTB
non-SMC condensin II complex, subunit G2
Anti-NCAPG2
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 54892
UniProt: Q86XI2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QVGHILELVDNWLPTEHAQAKSNTASKGRVQIHDTRPVKPELALVYIEYLLTHPKNRECLLSAPRKKLNHLLKALETSKADLESLLQTPGGKPRGFSEAAAPRAFGLHCRLSIHLQH
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: NCAPG2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts and Leydig cells.
Immunohistochemical staining of human prostate shows moderate nuclear positivity in glandular cells.
Immunohistochemical staining of human tonsil shows moderate nuclear positivity in germinal center and non-germinal center cells.
Immunohistochemical staining of human skeletal muscle shows weak to moderate nuclear positivity in myocytes.
HPA026631-100ul
HPA026631-100ul
HPA026631-100ul