Anti-NCAPG2 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA026631
- Images (9)
| Article Name: | Anti-NCAPG2 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA026631 |
| Supplier Catalog Number: | HPA026631 |
| Alternative Catalog Number: | ATA-HPA026631-100,ATA-HPA026631-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CAP-G2, FLJ20311, hCAP-G2, LUZP5, MTB |
| non-SMC condensin II complex, subunit G2 |
| Anti-NCAPG2 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 54892 |
| UniProt: | Q86XI2 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QVGHILELVDNWLPTEHAQAKSNTASKGRVQIHDTRPVKPELALVYIEYLLTHPKNRECLLSAPRKKLNHLLKALETSKADLESLLQTPGGKPRGFSEAAAPRAFGLHCRLSIHLQH |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NCAPG2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles. |
|
|
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts and Leydig cells. |
|
|
Immunohistochemical staining of human prostate shows moderate nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human tonsil shows moderate nuclear positivity in germinal center and non-germinal center cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows weak to moderate nuclear positivity in myocytes. |
|
|
HPA026631 |
|
|
|
|
|
HPA026631 |
|
|
HPA026631 |
Product Guarantee and Expert Support
