Anti-CCDC88B
Artikelnummer:
ATA-HPA026652
- Bilder (7)
| Artikelname: | Anti-CCDC88B |
| Artikelnummer: | ATA-HPA026652 |
| Hersteller Artikelnummer: | HPA026652 |
| Alternativnummer: | ATA-HPA026652-100,ATA-HPA026652-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BRLZ, CCDC88, FLJ00354, FLJ37970, GIPIE, HkRP3 |
| coiled-coil domain containing 88B |
| Anti-CCDC88B |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 283234 |
| UniProt: | A6NC98 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GLRQEGPEHKPGPSEPSSVQLEEQEGPNQGLDLATGQAEAREHDQRLEGTVRDPAWQKPQQKSEGALEVQVWEGPIPGESLASGVAEQEALREEVAQLRRKAEALGDELEAQARKLEAQNTEAARLSKELAQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CCDC88B |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human lung shows strong cytoplasmic positivity in macrophages. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells. |
|
|
Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells. |
|
|
HPA026652-100ul |
|
|
HPA026652-100ul |
|
|
HPA026652-100ul |
Produktgarantie und fachkundiger Support
