Anti-CCDC88B
Catalog Number:
ATA-HPA026652
- Images (7)
| Article Name: | Anti-CCDC88B |
| Biozol Catalog Number: | ATA-HPA026652 |
| Supplier Catalog Number: | HPA026652 |
| Alternative Catalog Number: | ATA-HPA026652-100,ATA-HPA026652-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BRLZ, CCDC88, FLJ00354, FLJ37970, GIPIE, HkRP3 |
| coiled-coil domain containing 88B |
| Anti-CCDC88B |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 283234 |
| UniProt: | A6NC98 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GLRQEGPEHKPGPSEPSSVQLEEQEGPNQGLDLATGQAEAREHDQRLEGTVRDPAWQKPQQKSEGALEVQVWEGPIPGESLASGVAEQEALREEVAQLRRKAEALGDELEAQARKLEAQNTEAARLSKELAQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CCDC88B |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human lung shows strong cytoplasmic positivity in macrophages. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells. |
|
|
Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells. |
|
|
HPA026652-100ul |
|
|
HPA026652-100ul |
|
|
HPA026652-100ul |
Product Guarantee and Expert Support
