Anti-STARD10

Artikelnummer: ATA-HPA026661
Artikelname: Anti-STARD10
Artikelnummer: ATA-HPA026661
Hersteller Artikelnummer: HPA026661
Alternativnummer: ATA-HPA026661-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CGI-52, NY-CO-28, PCTP2, SDCCAG28
StAR-related lipid transfer (START) domain containing 10
Anti-STARD10
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 10809
UniProt: Q9Y365
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: STARD10
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human breast shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human skeletal muscle shows weak positivity in myocytes as.
Western blot analysis in human cell lines MCF-7 and HeLa using Anti-STARD10 antibody. Corresponding STARD10 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
HPA026661-100ul
HPA026661-100ul
HPA026661-100ul