Anti-STARD10
Artikelnummer:
ATA-HPA026661
- Bilder (9)
| Artikelname: | Anti-STARD10 |
| Artikelnummer: | ATA-HPA026661 |
| Hersteller Artikelnummer: | HPA026661 |
| Alternativnummer: | ATA-HPA026661-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CGI-52, NY-CO-28, PCTP2, SDCCAG28 |
| StAR-related lipid transfer (START) domain containing 10 |
| Anti-STARD10 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10809 |
| UniProt: | Q9Y365 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | STARD10 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human rectum shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human breast shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows weak positivity in myocytes as. |
|
|
Western blot analysis in human cell lines MCF-7 and HeLa using Anti-STARD10 antibody. Corresponding STARD10 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
HPA026661-100ul |
|
|
|
|
|
HPA026661-100ul |
|
|
HPA026661-100ul |
Produktgarantie und fachkundiger Support
