Anti-STARD10 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-STARD10 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA026661
• Supplier Catalog Number: HPA026661
• Alternative Catalog Number: ATA-HPA026661-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CGI-52, NY-CO-28, PCTP2, SDCCAG28

Product Description

StAR-related lipid transfer (START) domain containing 10

Additional Information

Anti-STARD10

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 10809
• UniProt: Q9Y365
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: MECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYL
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: STARD10
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml

Images

Immunohistochemical staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human breast shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human skeletal muscle shows weak positivity in myocytes as.

Western blot analysis in human cell lines MCF-7 and HeLa using Anti-STARD10 antibody. Corresponding STARD10 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

HPA026661

HPA026661

HPA026661