Anti-STARD10

Catalog Number: ATA-HPA026661
Article Name: Anti-STARD10
Biozol Catalog Number: ATA-HPA026661
Supplier Catalog Number: HPA026661
Alternative Catalog Number: ATA-HPA026661-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CGI-52, NY-CO-28, PCTP2, SDCCAG28
StAR-related lipid transfer (START) domain containing 10
Anti-STARD10
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 10809
UniProt: Q9Y365
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: STARD10
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human breast shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human skeletal muscle shows weak positivity in myocytes as.
Western blot analysis in human cell lines MCF-7 and HeLa using Anti-STARD10 antibody. Corresponding STARD10 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
HPA026661-100ul
HPA026661-100ul
HPA026661-100ul