Anti-CLIP1

Artikelnummer: ATA-HPA026678
Artikelname: Anti-CLIP1
Artikelnummer: ATA-HPA026678
Hersteller Artikelnummer: HPA026678
Alternativnummer: ATA-HPA026678-100,ATA-HPA026678-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CLIP, CLIP-170, CLIP170, CYLN1, RSN
CAP-GLY domain containing linker protein 1
Anti-CLIP1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 6249
UniProt: P30622
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KNLELQLKENKRQLSSSSGNTDTQADEDERAQESQIDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCDICDCFDLHDTEDCPTQAQMSEDPPHSTHHGSRGEERPYCEICEMFGHWATNCNDDET
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CLIP1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line SiHa shows localization to microtubule ends.
Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Western blot analysis in human cell line HDLM-2 and human cell line U-2197.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA026678-100ul
HPA026678-100ul
HPA026678-100ul