Anti-CLIP1

Catalog Number: ATA-HPA026678
Article Name: Anti-CLIP1
Biozol Catalog Number: ATA-HPA026678
Supplier Catalog Number: HPA026678
Alternative Catalog Number: ATA-HPA026678-100,ATA-HPA026678-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CLIP, CLIP-170, CLIP170, CYLN1, RSN
CAP-GLY domain containing linker protein 1
Anti-CLIP1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 6249
UniProt: P30622
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KNLELQLKENKRQLSSSSGNTDTQADEDERAQESQIDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCDICDCFDLHDTEDCPTQAQMSEDPPHSTHHGSRGEERPYCEICEMFGHWATNCNDDET
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CLIP1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line SiHa shows localization to microtubule ends.
Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Western blot analysis in human cell line HDLM-2 and human cell line U-2197.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA026678-100ul
HPA026678-100ul
HPA026678-100ul