Anti-CLIP1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CLIP1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA026678
• Supplier Catalog Number: HPA026678
• Alternative Catalog Number: ATA-HPA026678-100,ATA-HPA026678-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CLIP, CLIP-170, CLIP170, CYLN1, RSN

Product Description

CAP-GLY domain containing linker protein 1

Additional Information

Anti-CLIP1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 6249
• UniProt: P30622
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: KNLELQLKENKRQLSSSSGNTDTQADEDERAQESQIDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCDICDCFDLHDTEDCPTQAQMSEDPPHSTHHGSRGEERPYCEICEMFGHWATNCNDDET
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CLIP1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line SiHa shows localization to microtubule ends.

Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Western blot analysis in human cell line HDLM-2 and human cell line U-2197.

Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

HPA026678

HPA026678

HPA026678