Anti-FGL2

Artikelnummer: ATA-HPA026682
Artikelname: Anti-FGL2
Artikelnummer: ATA-HPA026682
Hersteller Artikelnummer: HPA026682
Alternativnummer: ATA-HPA026682-100,ATA-HPA026682-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: pT49, T49
fibrinogen-like 2
Anti-FGL2
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 10875
UniProt: Q14314
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: FGL2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using Anti-FGL2 antibody. Corresponding FGL2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human liver, lymph node, skeletal muscle and spleen using Anti-FGL2 antibody HPA026682 (A) shows similar protein distribution across tissues to independent antibody HPA021011 (B).
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Immunohistochemical staining of human lymph node shows high expression.
Immunohistochemical staining of human liver using Anti-FGL2 antibody HPA026682.
Immunohistochemical staining of human spleen using Anti-FGL2 antibody HPA026682.
HPA026682-100ul
HPA026682-100ul
HPA026682-100ul