Anti-FGL2 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-FGL2 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA026682
• Supplier Catalog Number: HPA026682
• Alternative Catalog Number: ATA-HPA026682-100,ATA-HPA026682-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: pT49, T49

Product Description

fibrinogen-like 2

Additional Information

Anti-FGL2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.3 mg/ml
• Isotype: IgG
• NCBI: 10875
• UniProt: Q14314
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: SQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRR
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: FGL2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using Anti-FGL2 antibody. Corresponding FGL2 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human liver, lymph node, skeletal muscle and spleen using Anti-FGL2 antibody HPA026682 (A) shows similar protein distribution across tissues to independent antibody HPA021011 (B).

Immunohistochemical staining of human skeletal muscle shows low expression as expected.

Immunohistochemical staining of human lymph node shows high expression.

Immunohistochemical staining of human liver using Anti-FGL2 antibody HPA026682.

Immunohistochemical staining of human spleen using Anti-FGL2 antibody HPA026682.

HPA026682

HPA026682

HPA026682