Anti-FGL2

Catalog Number: ATA-HPA026682
Article Name: Anti-FGL2
Biozol Catalog Number: ATA-HPA026682
Supplier Catalog Number: HPA026682
Alternative Catalog Number: ATA-HPA026682-100,ATA-HPA026682-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: pT49, T49
fibrinogen-like 2
Anti-FGL2
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 10875
UniProt: Q14314
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRR
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FGL2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using Anti-FGL2 antibody. Corresponding FGL2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human liver, lymph node, skeletal muscle and spleen using Anti-FGL2 antibody HPA026682 (A) shows similar protein distribution across tissues to independent antibody HPA021011 (B).
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Immunohistochemical staining of human lymph node shows high expression.
Immunohistochemical staining of human liver using Anti-FGL2 antibody HPA026682.
Immunohistochemical staining of human spleen using Anti-FGL2 antibody HPA026682.
HPA026682-100ul
HPA026682-100ul
HPA026682-100ul