Anti-CA3 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA026700
Artikelname: Anti-CA3 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA026700
Hersteller Artikelnummer: HPA026700
Alternativnummer: ATA-HPA026700-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CAIII, Car3
carbonic anhydrase III, muscle specific
Anti-CA3
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 761
UniProt: P07451
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: YWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CA3
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human skeletal muscle and heart muscle tissues using Anti-CA3 antibody. Corresponding CA3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human heart muscle shows low expression as expected.
Immunohistochemical staining of human skeletal muscle shows high expression.
Western blot analysis using Anti-CA3 antibody HPA026700 (A) shows similar pattern to independent antibody HPA021775 (B).
Western blot analysis in control (vector only transfected HEK293T lysate) and CA3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY417461).
HPA026700
HPA026700
HPA026700