Anti-CA3

Catalog Number: ATA-HPA026700
Article Name: Anti-CA3
Biozol Catalog Number: ATA-HPA026700
Supplier Catalog Number: HPA026700
Alternative Catalog Number: ATA-HPA026700-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CAIII, Car3
carbonic anhydrase III, muscle specific
Anti-CA3
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 761
UniProt: P07451
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CA3
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human skeletal muscle and heart muscle tissues using Anti-CA3 antibody. Corresponding CA3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human heart muscle shows low expression as expected.
Immunohistochemical staining of human skeletal muscle shows high expression.
Western blot analysis using Anti-CA3 antibody HPA026700 (A) shows similar pattern to independent antibody HPA021775 (B).
Western blot analysis in control (vector only transfected HEK293T lysate) and CA3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY417461).
HPA026700-100ul
HPA026700-100ul
HPA026700-100ul