Anti-FAM221A
Artikelnummer:
ATA-HPA026748
- Bilder (8)
| Artikelname: | Anti-FAM221A |
| Artikelnummer: | ATA-HPA026748 |
| Hersteller Artikelnummer: | HPA026748 |
| Alternativnummer: | ATA-HPA026748-100,ATA-HPA026748-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C7orf46, DKFZp686F0810, FLJ45875, MGC72075 |
| family with sequence similarity 221, member A |
| Anti-FAM221A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 340277 |
| UniProt: | A4D161 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DSPFLKAFQASSSSSPETLTDVGTSSQVSSLRRPEEDDMAFFERRYQERMKMEKAAKWKGKAPLPSATK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FAM221A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human testis and endometrium tissues using Anti-FAM221A antibody. Corresponding FAM221A RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human endometrium shows low expression as expected. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Western blot analysis using Anti-FAM221A antibody HPA026748 (A) shows similar pattern to independent antibody HPA026752 (B). |
|
|
|
|
|
HPA026748-100ul |
|
|
HPA026748-100ul |
|
|
HPA026748-100ul |
Produktgarantie und fachkundiger Support
