Anti-FAM221A
Catalog Number:
ATA-HPA026748
- Images (8)
| Article Name: | Anti-FAM221A |
| Biozol Catalog Number: | ATA-HPA026748 |
| Supplier Catalog Number: | HPA026748 |
| Alternative Catalog Number: | ATA-HPA026748-100,ATA-HPA026748-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C7orf46, DKFZp686F0810, FLJ45875, MGC72075 |
| family with sequence similarity 221, member A |
| Anti-FAM221A |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 340277 |
| UniProt: | A4D161 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DSPFLKAFQASSSSSPETLTDVGTSSQVSSLRRPEEDDMAFFERRYQERMKMEKAAKWKGKAPLPSATK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FAM221A |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human testis and endometrium tissues using Anti-FAM221A antibody. Corresponding FAM221A RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human endometrium shows low expression as expected. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Western blot analysis using Anti-FAM221A antibody HPA026748 (A) shows similar pattern to independent antibody HPA026752 (B). |
|
|
|
|
|
HPA026748-100ul |
|
|
HPA026748-100ul |
|
|
HPA026748-100ul |
Product Guarantee and Expert Support
