Anti-EPCAM Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA026761
Artikelname: Anti-EPCAM Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA026761
Hersteller Artikelnummer: HPA026761
Alternativnummer: ATA-HPA026761-100,ATA-HPA026761-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: 17-1A, 323/A3, CD326, CO-17A, EGP-2, EGP34, EGP40, Ep-CAM, ESA, GA733-2, HEA125, KS1/4, KSA, Ly74, M4S1, MH99, MIC18, MK-1, MOC31, TACST-1, TACSTD1, TROP1
epithelial cell adhesion molecule
Anti-EPCAM
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 4072
UniProt: P16422
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYY
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: EPCAM
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human rectum and liver tissues using Anti-EPCAM antibody. Corresponding EPCAM RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human rectum shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Western blot analysis in human cell lines Caco-2 and U-251MG using Anti-EPCAM antibody. Corresponding EPCAM RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.
Western blot analysis in control (vector only transfected HEK293T lysate) and EPCAM over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400847).
HPA026761
HPA026761
HPA026761