Anti-EPCAM Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA026761
- Images (9)
| Article Name: | Anti-EPCAM Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA026761 |
| Supplier Catalog Number: | HPA026761 |
| Alternative Catalog Number: | ATA-HPA026761-100,ATA-HPA026761-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | 17-1A, 323/A3, CD326, CO-17A, EGP-2, EGP34, EGP40, Ep-CAM, ESA, GA733-2, HEA125, KS1/4, KSA, Ly74, M4S1, MH99, MIC18, MK-1, MOC31, TACST-1, TACSTD1, TROP1 |
| epithelial cell adhesion molecule |
| Anti-EPCAM |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 4072 |
| UniProt: | P16422 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYY |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | EPCAM |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human rectum and liver tissues using Anti-EPCAM antibody. Corresponding EPCAM RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human rectum shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Western blot analysis in human cell lines Caco-2 and U-251MG using Anti-EPCAM antibody. Corresponding EPCAM RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and EPCAM over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400847). |
|
|
HPA026761 |
|
|
|
|
|
HPA026761 |
|
|
HPA026761 |
Product Guarantee and Expert Support
