Anti-TNN
Artikelnummer:
ATA-HPA026764
- Bilder (7)
| Artikelname: | Anti-TNN |
| Artikelnummer: | ATA-HPA026764 |
| Hersteller Artikelnummer: | HPA026764 |
| Alternativnummer: | ATA-HPA026764-100,ATA-HPA026764-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | TNN |
| tenascin N |
| Anti-TNN |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 63923 |
| UniProt: | Q9UQP3 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KEQQVTVSHTYKIDVPKSALVQVDADPQPLSDDGASLLALGEAREEQNIIFRHNIRLQTPQKDCELAGSVQDLLARVKKLEEEMVEMKEQCSA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TNN |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human breast shows moderate to strong cytoplasmic and membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human salivary gland shows weak cytoplasmic and moderate to strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human prostate shows moderate to strong cytoplasmic positivity in a subset of glandular cells. |
|
|
HPA026764-100ul |
|
|
HPA026764-100ul |
|
|
HPA026764-100ul |
Produktgarantie und fachkundiger Support
